The domain within your query sequence starts at position 1 and ends at position 100; the E-value for the DUF4600 domain shown below is 2e-38.
MEKMRGNPSDRLSSIRVYEKMPVESLNVLLKQLEKEKRSLESQVKEYAFRLEQESKAYHR TNNERRSYIAEMTQVSGSNQVSKRQQMDPLPRMKESPVKT
DUF4600 |
 |
|---|
| PFAM accession number: | PF15372 |
|---|---|
| Interpro abstract (IPR028022): | Some members of this family are also annotated as coiled-coil domain-containing protein 169 (CCDC169). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4600