The domain within your query sequence starts at position 119 and ends at position 243; the E-value for the DUF4602 domain shown below is 1e-32.
EFQSKSKKRKLKSDEDEPAKNKTKVVKKDVDIQEFNLEKARLEVHRFGITGYGKGKERVL ERERAIMLGAKPPKNTYVNYKVLQKQIKEKKIAVEEEKRAARETDIFKKKKKKGRGQEDR RSKKS
DUF4602 |
---|
PFAM accession number: | PF15375 |
---|---|
Interpro abstract (IPR027973): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 173 and 294 amino acids in length. This family includes Human C1orf131. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4602