The domain within your query sequence starts at position 61 and ends at position 100; the E-value for the DUF4605 domain shown below is 3e-20.
SPFSDLNRQLVNMGFPQWHLGNHVVEPVTSILLLFLLMML
DUF4605 |
---|
PFAM accession number: | PF15378 |
---|---|
Interpro abstract (IPR027953): | This domain of unknown function is found in eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4605