The domain within your query sequence starts at position 2 and ends at position 118; the E-value for the DUF4612 domain shown below is 2.9e-48.
GCASAKHVATVQNEEEAQRGKSYQNGDVFGDEYRIKPVEEVKYMKNGAEEEQKIAARNQE NLEKSASSNTRLKTNKEIPGLVHQPRANMHISESQQEFFRMLDEKIEKGRDYCSEEE
DUF4612 |
 |
|---|
| PFAM accession number: | PF15389 |
|---|---|
| Interpro abstract (IPR027967): | This protein family is a domain of unknown function, which is found in eukaryotes. Proteins in this family are typically between 109 and 323 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4612