The domain within your query sequence starts at position 438 and ends at position 608; the E-value for the DUF4614 domain shown below is 2e-71.
SPAYSEDFEQFSGPLALEESLDRTLDTLSKFSSSGQTDIVARQPLSRTEWGRGVTRVVKE TAVQTLDPAFAYQWSKAGGIAAVGPALGGAYVDPAPIASHIVSADAIEALTAYSPAVLAL NDMLKQQLSLTQQFIEASHQLHGSLLQSLDGDSFHYHTLEEAKEYIRCHRP
DUF4614 |
---|
PFAM accession number: | PF15391 |
---|---|
Interpro abstract (IPR027884): | This domain is found in eukaryotes, and contains a conserved EALT sequence motif. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4614