The domain within your query sequence starts at position 97 and ends at position 158; the E-value for the DUF4618 domain shown below is 1.4e-22.

LRNQRTSLQELYSHEGYLSKLNKELIKAILDTEDSVALSVREMLQQQSILGSIIDILEYS
NK

DUF4618

DUF4618
PFAM accession number:PF15397
Interpro abstract (IPR029236):

This family of proteins is found in eukaryotes. Proteins in this family are typically between 238 and 363 amino acids in length. There are two conserved sequence motifs: EYP and KCTPD.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4618