The domain within your query sequence starts at position 97 and ends at position 158; the E-value for the DUF4618 domain shown below is 1.4e-22.
LRNQRTSLQELYSHEGYLSKLNKELIKAILDTEDSVALSVREMLQQQSILGSIIDILEYS NK
DUF4618 |
 |
|---|
| PFAM accession number: | PF15397 |
|---|---|
| Interpro abstract (IPR029236): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 238 and 363 amino acids in length. There are two conserved sequence motifs: EYP and KCTPD. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4618