The domain within your query sequence starts at position 1 and ends at position 67; the E-value for the DUF4636 domain shown below is 4.2e-32.
MLLKMSESKQDEDSGTSASLSKASKETSCKRQNREGSWDSSLVMKKPKQNQVSTVTDSEV ALVSAY
DUF4636 |
![]() |
---|
PFAM accession number: | PF15468 |
---|---|
Interpro abstract (IPR027955): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 196 and 244 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4636