The domain within your query sequence starts at position 42 and ends at position 207; the E-value for the DUF4648 domain shown below is 2.2e-87.
VVIESDLYPPPRPLELLPQRCERRDTGDRRWLQTGRLQTARPPGAHPTKTPSRPVGISEP KTSNLCGNRAYGKSLIPPVARISVKAPAGAEVAAKGSEHGAVLGRGSRHLKKIAEEYPAL PQGAEASLPLTGSTSCGVPGILRKMWTRHKKKSEYVGATNSAFEAD
DUF4648 |
![]() |
---|
PFAM accession number: | PF15505 |
---|---|
Interpro abstract (IPR027900): | This entry corresponds to a presumed SH3 domain. Proteins containing this domain include Xenopus laevis Vexin and its human homologue, C8orf46. Vexin is transiently expressed in differentiating progenitors in the developing central nervous system (CNS) and is required for neurogenesis in the neural plate and retina [ (PUBMED:29518376) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4648