The domain within your query sequence starts at position 32 and ends at position 165; the E-value for the DUF4658 domain shown below is 4e-47.
PSRTERDGNRKCPPSILRPRRQECGCHGGEPQKTSRHVRFREPLEVAVHYIARKDTTAAI KVPSRPASHGGSPLQPASRSGSLFLWLTLCALLGVVLVLYCGQAKRVTAALEDLLAQLLA LILRLWCVVLACWH
DUF4658 |
![]() |
---|
PFAM accession number: | PF15555 |
---|---|
Interpro abstract (IPR028114): | This family of proteins is found in eukaryotes and includes human transmembrane protein C14orf180. Proteins in this family are typically between 129 and 161 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4658