The domain within your query sequence starts at position 475 and ends at position 613; the E-value for the DUF4682 domain shown below is 4.3e-50.
INALKRQYSRIKKKQQQQLHQVYIRADKGPVTSILPSQANSSPVINHLLLGKKMKITNRA AKNAVIHVPGHPGGKISPVPYEDIKTKLNSPWRTHIRVHKKNMPRTKSHLGCGDTVGLIE EQSEGCKASSLGAAEEFPS
DUF4682 |
![]() |
---|
PFAM accession number: | PF15733 |
---|---|
Interpro abstract (IPR032738): | This entry represents the C-terminal domain of the TBC1 domain family member 30 (Tbc1d30). Tbc1d30 is a GTPase-activating protein (GAP) with broad specificity [ (PUBMED:19077034) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4682