The domain within your query sequence starts at position 559 and ends at position 639; the E-value for the DUF4683 domain shown below is 6.4e-15.
KEPTVVAAEAATVTAATMAMPEVKKRRRRKQKLASPQPSYAADANDSKAEYSDVLAKLAF LNRQSQCAGRCSPPRCWTPSE
DUF4683 |
 |
|---|
| PFAM accession number: | PF15735 |
|---|---|
| Interpro abstract (IPR032757): | This domain is found in eukaryotes, and is typically between 384 and 400 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4683