The domain within your query sequence starts at position 164 and ends at position 245; the E-value for the DUF4685 domain shown below is 2.7e-20.
FLPDLWDKPLHWDNNFKEKTTLGLPRGELARAKKAHPPAGEGSRPRKRYCPFRVRFADET LQDTALRYWERNRAVRQNIFPS
DUF4685 |
---|
PFAM accession number: | PF15737 |
---|---|
Interpro abstract (IPR032756): | This domain is found in vertebrates, and is typically between 106 and 131 amino acids in length. There are two conserved sequence motifs: SGE and VRF. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4685