The domain within your query sequence starts at position 31 and ends at position 135; the E-value for the DUF4706 domain shown below is 4.1e-45.
TYFSSLSPMARKIMQDKEKIREKYGPEWARLPPAQQDEIIDRCLVGPRAPAAAADAGDVR DPARFPGLRGPTGQKLVRFGDEDITWQDEHSAPFSWETRSQMEFS
DUF4706 |
 |
|---|
| PFAM accession number: | PF15797 |
|---|---|
| Interpro abstract (IPR031600): | This domain is found in eukaryotes, and is approximately 110 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4706