The domain within your query sequence starts at position 36 and ends at position 145; the E-value for the DUF4709 domain shown below is 1e-45.

RLAISDDLKVGFFTSDHATQTDCSEVFPLKDLTQSTEKLMRIITSLHVDFGFLKDLVQLK
FEERLKEESWKIVGMLCDKMLEMKRHYQQGEDIMRKSFQQQLCDAIAIIK

DUF4709

• PFAM accession number: PF15821
• Interpro abstract (IPR031651):

  This domain is found in eukaryotes, and is approximately 110 amino acids in length. There is a conserved QQL sequence motif.

  It is sometimes found C-terminal to ( IPR031711 ).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4709