The domain within your query sequence starts at position 477 and ends at position 559; the E-value for the DUF4724 domain shown below is 3.9e-24.
MFTRQTLYRQYAMTGDTSFNYIKVKPLYVHSTVNMAEPSSPPNVPHPPMVDPSNENTRSD QVFPGVTSDSRDNTDSWNREDHF
DUF4724 |
---|
PFAM accession number: | PF15852 |
---|---|
Interpro abstract (IPR031711): | This domain is found in mammals and has a conserved KVKPL sequence motif. It is sometimes found N-terminal to ( IPR031651 ). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4724