The domain within your query sequence starts at position 477 and ends at position 559; the E-value for the DUF4724 domain shown below is 3.9e-24.

MFTRQTLYRQYAMTGDTSFNYIKVKPLYVHSTVNMAEPSSPPNVPHPPMVDPSNENTRSD
QVFPGVTSDSRDNTDSWNREDHF

DUF4724

• PFAM accession number: PF15852
• Interpro abstract (IPR031711):

  This domain is found in mammals and has a conserved KVKPL sequence motif.

  It is sometimes found N-terminal to ( IPR031651 ).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4724