The domain within your query sequence starts at position 10 and ends at position 110; the E-value for the DUF4726 domain shown below is 2e-66.
SRGEAAGVDRGKAGLGLGGRPPPQPPRDERAQQLLDAVEQRQRQLLDTIAACEEMLRQLG RRRPEPAGGGNGSAKSGAPPQPSVSARGGLPKDAGDGASES
DUF4726 |
---|
PFAM accession number: | PF15855 |
---|---|
Interpro abstract (IPR031714): | This family of proteins is found in vertebrates. Proteins in this family are typically between 40 and 110 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4726