The domain within your query sequence starts at position 1 and ends at position 52; the E-value for the DUF4750 domain shown below is 2.2e-24.
MWHNVGLTLLVFVATLLIVLLLMVCGWYFVWHLFLSKFKFLRELVGDTGSQE
DUF4750 |
 |
|---|
| PFAM accession number: | PF15938 |
|---|---|
| Interpro abstract (IPR031851): | This family of uncharacterised proteins includes proteins described as small integral membrane protein 13. This family of proteins is found in eukaryotes. There are two completely conserved W residues that may be functionally important. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4750