The domain within your query sequence starts at position 2 and ends at position 110; the E-value for the DUF4772 domain shown below is 5.3e-31.
LSRRLGKRSLLGARVLGPSAAEVPSGATLPLEPQIEVPEGAMSLSPLTSKDPVCQEQPKE LLKALGTSGHPQVAFQPGQKVCVWYGGQECKGLVEQHSWAEDKVTVRLL
DUF4772 |
 |
|---|
| PFAM accession number: | PF15997 |
|---|---|
| Interpro abstract (IPR031940): | This presumed domain is functionally uncharacterised. This domain is found in eukaryotes, and is typically between 107 and 124 amino acids in length. There is a single completely conserved residue V that may be functionally important. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4772