The domain within your query sequence starts at position 249 and ends at position 346; the E-value for the DUF4819 domain shown below is 1.8e-23.
VDVVLDVTPPPGALMVGTAVCTCVEPGVAAYREGVVVEVATKPAAYKVRLSPGPSSHAGP PGTLPQAQQTLHREPEEAVWVTRSSLRLLRPPWEPGAL
DUF4819 |
 |
|---|
| PFAM accession number: | PF16090 |
|---|---|
| Interpro abstract (IPR032147): | This presumed domain is functionally uncharacterised. It is found in a subset of transcriptional repressor capicua proteins [ (PUBMED:17190598) (PUBMED:25059278) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4819