The domain within your query sequence starts at position 15 and ends at position 272; the E-value for the DUF4821 domain shown below is 1.1e-96.
HCRRTESQDIFCIKNLVRKFTQKLFGRLNIIYLLEKANLAVTVCNDKEEIMAHSIFLDYP NWNVAKQDNWIPLFRELDKEIPCTPLNTLFMHFFVAVDEYATGCLKEIIRTVFKAVPELY FIFLIVPTYLSLGSTLITVFDQVGNIPCLNYNEDFAVHICHRHNHYPQLHIRKARVEDHD DLMPIFMHYDNTLKEIYGEYFLAELIEAQDKDHHAVVCEVEGKAVGFMSVCTSVNLPLLH ECFDLGPFHGFCTPHPDD
DUF4821 |
---|
PFAM accession number: | PF16092 |
---|---|
Interpro abstract (IPR032151): | This entry represents the N-terminal domain of proteins described as cilia- and flagella-associated protein. Proteins containing this domain includes FAP61 from Chlamydomonas reinhardtii. FAP61 is part of the calmodulin and spoke-associated complex (CSC) required for wild-type motility and for the stable assembly of a subset of radial spokes in motile cilia [ (PUBMED:25694453) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4821