The domain within your query sequence starts at position 400 and ends at position 477; the E-value for the DUF4976 domain shown below is 1.5e-12.
QDFYVSPTFQDLLNRTTTGRPTGWYKDLHRYYYRERWELYDISRDPRETRNLAADPDLAQ VLEMLKAQLVKWQWETHD
DUF4976 |
![]() |
---|
PFAM accession number: | PF16347 |
---|---|
Interpro abstract (IPR032506): | This entry represents a domain found in a group of uncharacterised proteins around 530 residues in length. Several proteins containing this domain are annotated as Arylsulfatases, but the function of this protein is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4976