The domain within your query sequence starts at position 400 and ends at position 477; the E-value for the DUF4976 domain shown below is 1.5e-12.

QDFYVSPTFQDLLNRTTTGRPTGWYKDLHRYYYRERWELYDISRDPRETRNLAADPDLAQ
VLEMLKAQLVKWQWETHD

DUF4976

 DUF4976
PFAM accession number:PF16347
Interpro abstract (IPR032506):

This entry represents a domain found in a group of uncharacterised proteins around 530 residues in length. Several proteins containing this domain are annotated as Arylsulfatases, but the function of this protein is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4976