The domain within your query sequence starts at position 1 and ends at position 63; the E-value for the DUF543 domain shown below is 1.4e-27.
MSESELGRKWDRCMADTVVKLGTGFGLGIVFSLTFFKRRMWPLAFGSGVGLGMAYSNCQH DFQ
DUF543 |
 |
|---|
| PFAM accession number: | PF04418 |
|---|---|
| Interpro abstract (IPR007512): | Mic10 (also known as MINOS1) is a component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane [ (PUBMED:22114354) ]. |
| GO component: | mitochondrial inner membrane (GO:0005743), MICOS complex (GO:0061617) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF543