The domain within your query sequence starts at position 62 and ends at position 301; the E-value for the DUF647 domain shown below is 5.6e-97.
WAALTALSGLRSVLLPQGFPDSVSPDYLPYQLWDSVQAFASSLSGSLATQAVLQGLGVGN AKASVSAATSTWLVKDSTGMLGRIIFAWWKGSKLDCNAKQWRLFADILNDVAMFLEIMAP MYPIFFTMTVSTSNLAKCIVGVAGGATRAALTMHQARRNNMADVSAKDSSQETVVNLAGL LVSLLMLPLVSDCPSLSLGCFVLLTALHIYANYRAVRALVLETLNESRLQLVLEHFLQRG
DUF647 |
---|
PFAM accession number: | PF04884 |
---|---|
Interpro abstract (IPR006968): | This family is composed of root UVB sensitive proteins and their homologues. In Arabidopsis thaliana, proteins in this family are involved in UVB-sensing and in early seedling morphogenesis and development [ (PUBMED:19075229) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF647