The domain within your query sequence starts at position 117 and ends at position 238; the E-value for the DUF716 domain shown below is 2.8e-37.
LGLDRVVLAMAVFIEGFLFYFHVHNRPPLDQHIHSLLLFGLFGAAVSISLEVILRDNIVL ELFRTSLLILQGTWFWQIGFVLFPPFGRPEWDQKDMDNIMFITMCFCWHYLVALCIVAIN YS
DUF716 |
---|
PFAM accession number: | PF04819 |
---|---|
Interpro abstract (IPR006904): | These sequences are a family of uncharacterised hypothetical proteins restricted to eukaryotes ( Q9SLW7 ) represents a sequence from Nicotiana tabacum (Common tobacco) which is up regulated in response to TMV infection. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF716