The domain within your query sequence starts at position 121 and ends at position 177; the E-value for the DUF719 domain shown below is 7e-16.

SSQAGRWAGWGSWGKSLLSSASATVGHGLTAVKEKAGATLRIHSANSASPEGAPTD

DUF719

DUF719
PFAM accession number:PF05334
Interpro abstract (IPR007998):

This family consists of several eukaryotic proteins of unknown function.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF719