The domain within your query sequence starts at position 77 and ends at position 243; the E-value for the DUF719 domain shown below is 4.5e-71.
TGWGYWGSWGKSLLSSASATVATVGQGISNVIEKAETSLGIPSPTEISAEVKQAAGEKNA GENGSLLVAAPFGMLSTISTAVQSTGKSVISGGLDALEFIGKKTMDVIAEGDPGFKRTKG LMNRTSTLSQVLREAKDKEEQRPSNEVTMETDKKTHYGLLFDEFQGL
DUF719 |
---|
PFAM accession number: | PF05334 |
---|---|
Interpro abstract (IPR007998): | This family consists of several eukaryotic proteins of unknown function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF719