The domain within your query sequence starts at position 38 and ends at position 138; the E-value for the DUF727 domain shown below is 1.2e-36.
MQLEAEAVVNDVLFAVNHMFVSKSMPCADDVAYINVETKERNRYCLELTEAGLRVVGYAF DQVEDHLQTPYHETVYSLLDTLSPAYREAFGNALLQRLEAL
DUF727 |
 |
|---|
| PFAM accession number: | PF05303 |
|---|---|
| Interpro abstract (IPR007967): | This domain is found in GSK3-beta interaction protein (GSKIP), which binds to GSK3beta [ (PUBMED:16981698) ]. It is also found as a short domain towards the N terminus in clustered mitochondria protein, also known as clueless in Drosophila, which is involved in proper cytoplasmic distribution of mitochondria [ (PUBMED:19638420) (PUBMED:14617080) (PUBMED:9601101) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF727