The domain within your query sequence starts at position 1 and ends at position 140; the E-value for the DUF773 domain shown below is 2.2e-79.
MPESQEIAQLLSGSYIHYFHCLRIVDLLKGTEASTKNIFGRYSSQRMKDWQEIVSLYEKD NTYLVELCSLLVRNVSYEIPSLKKQIAKCQQLQQEYSRKEEEGQAGAAEMREQFYHSCKQ YGITGDNVRRELLALVKDLP
DUF773 |
---|
PFAM accession number: | PF05600 |
---|---|
Interpro abstract (IPR008491): | CDK5RAP3 (also known as C53 or LZAP) serves as a probable tumour suppressor initially identified as a CDK5R1 interactor controlling cell proliferation [ (PUBMED:12054757) (PUBMED:12737517) ]. It negatively regulates NF-kappa-B-mediated gene transcription through the control of RELA phosphorylation [ (PUBMED:17785205) (PUBMED:20228063) ]. It also regulates mitotic G2/M transition checkpoint and mitotic G2 DNA damage checkpoint [ (PUBMED:15790566) (PUBMED:19223857) ]. It has been shown to bind Wip1 and stimulates its phosphatase activity [ (PUBMED:28027003) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF773