The domain within your query sequence starts at position 3 and ends at position 105; the E-value for the DUF815 domain shown below is 4.8e-8.
AAAPSQQRPAAARARNLPWVEKYRPQTLADLISHQDILSTIQKFISEDRLPHLLLYGPPG TGKTSTILACAKQLYKDKEFGSMVLEVKETLSLHNSSDLQTLN
DUF815 |
---|
PFAM accession number: | PF05673 |
---|---|
Interpro abstract (IPR008533): | This domain consists of several bacterial proteins of unknown function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF815