The domain within your query sequence starts at position 3 and ends at position 118; the E-value for the DUF872 domain shown below is 1.7e-22.
PSRTNLATGLPSSKVKYSRLASTDDGYIDLQFKKSPPKIPYKAIALATVLFLIGTFLIII GSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDF
DUF872 |
 |
|---|
| PFAM accession number: | PF05915 |
|---|---|
| Interpro abstract (IPR008590): | This entry represents several uncharacterised eukaryotic transmembrane proteins. The function of this currently unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF872