The domain within your query sequence starts at position 20 and ends at position 187; the E-value for the DUF89 domain shown below is 1.2e-33.

TIKDRTPQILTKVIDTLHRHKSEFFEKHGEEGIEAEKKAISLLSKLRNELQTDKPITPLV
DKCVDTHIWNQYLEYQRSLLNEGDGEPRWFFSPWLFVECYMYRRIHEAIMQSPPIHDFDV
FKESKEENFFESQGSIDALCSHLLQLKPVKGLREEQIQDEFFKLLQVY

DUF89

DUF89
PFAM accession number:PF01937
Interpro abstract (IPR002791):

This domain is found in putative carboxyl methyltransferase Armt1, uncharacterized budding yeast protein YMR027W (PDB code: 3PT1), At2g17340 from Arabidopsis thaliana, and it is also found at the C-terminal portion of eukaryotic pantothenate kinases [ (PUBMED:16511115) (PUBMED:25732820) ]. Despite the characterization of Armt1 as a carboxyl methyltransferase, a second study suggests that these proteins are hydrolases whose function is to limit potentially harmful buildups of phosphometabolites [ (PUBMED:27322068) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF89