The domain within your query sequence starts at position 309 and ends at position 472; the E-value for the DUF89 domain shown below is 1.9e-30.
CFEEALDGVVKRAVASQPESMDAVERAEKFRQKYWGKLQTLRHQPFAYGTLTVRSLLDTR EHCLNEFNFPDPYSKVKQKENGLALKCFQSVTRSLDSLGWEERQLALVKGLLAGNVFDWG AKAVSDVLESDPQFGFEEAKRKLQERPWLVDSYTKWLQRLKITV
DUF89 |
![]() |
---|
PFAM accession number: | PF01937 |
---|---|
Interpro abstract (IPR002791): | This domain is found in putative carboxyl methyltransferase Armt1, uncharacterized budding yeast protein YMR027W (PDB code: 3PT1), At2g17340 from Arabidopsis thaliana, and it is also found at the C-terminal portion of eukaryotic pantothenate kinases [ (PUBMED:16511115) (PUBMED:25732820) ]. Despite the characterization of Armt1 as a carboxyl methyltransferase, a second study suggests that these proteins are hydrolases whose function is to limit potentially harmful buildups of phosphometabolites [ (PUBMED:27322068) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF89