The domain within your query sequence starts at position 90 and ends at position 369; the E-value for the DUF908 domain shown below is 4.2e-38.
KMLLLAVLNFTALLIEYSFSRHLYSSIEHLTTLLASSDMQVVLAVLNLLYVFSKRSNYIT RLGSDKRTPLLTRLQHLAESWGGKENGFGLAECCRDLQMLKYPPSATTLHFEFYADPGAE VKIEKRTTSNTLHYIHIEQLDKISESPSEIMESLTKMYSIPKDKQMLLFTHIRLAHGFSN HRKRLQAVQARLHAISILVYSNALQESANSILYNGLIEELVDVLQITDKQLMEIKAASLR TLTSIVHLERTPKLSSIIDCTGTASYHGFLPVLVRNCIQA
DUF908 |
---|
PFAM accession number: | PF06012 |
---|---|
Interpro abstract (IPR010309): | This is a domain of unknown function found at the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing. This domain is found in association with and immediately N-terminal to another domain of unknown function: IPR010314 . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF908