The domain within your query sequence starts at position 64 and ends at position 106; the E-value for the DUF938 domain shown below is 3.5e-17.

LDRNPEWGLRDTVLLEELGQASGLVLERMVDMPANNKCLIFRK

DUF938

DUF938
PFAM accession number:PF06080
Interpro abstract (IPR010342):

This family consists of several hypothetical proteins from both prokaryotes and eukaryotes. Chordate members are known as 'methyltransferase-like 26'. The function of this family is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF938