The domain within your query sequence starts at position 2 and ends at position 60; the E-value for the Defensin_big domain shown below is 3.4e-9.
RLALLLLAILVATELVVSGKNPILQCMGNRGFCRSSCKKSEQAYFYCRTFQMCCLQSYV
Defensin_big |
 |
|---|
| PFAM accession number: | PF14862 |
|---|---|
| Interpro abstract (IPR028060): | Big defensins are antimicrobial peptides. They consist of a hydrophobic N-terminal half, which is active against Gram-positive bacteria, and a cationic C-terminal half, which is active against Gram-negative bacteria. The C-terminal half adopts a beta-defensin-like structure [ (PUBMED:8586631) (PUBMED:18785751) ]. |
| GO process: | defense response to Gram-negative bacterium (GO:0050829), defense response to Gram-positive bacterium (GO:0050830) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Defensin_big