The domain within your query sequence starts at position 1083 and ends at position 1161; the E-value for the Dimer_Tnp_hAT domain shown below is 1.8e-10.
LAYLEEEVLEHSCDPLTYWNLKRSSWPGLSTLAVRFLGCPPSTVPSEKLFSTPMDAGSFG QPRLMMEHFEKLIFLKVNL
Dimer_Tnp_hAT |
---|
PFAM accession number: | PF05699 |
---|---|
Interpro abstract (IPR008906): | This dimerisation domain is found at the C terminus of the transposases of elements belonging to the Activator superfamily (hAT element superfamily). The isolated dimerisation domain forms extremely stable dimers in vitro [ (PUBMED:10662858) (PUBMED:11454746) ]. |
GO function: | protein dimerization activity (GO:0046983) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dimer_Tnp_hAT