The domain within your query sequence starts at position 142 and ends at position 213; the E-value for the Dishevelled domain shown below is 1.6e-36.
QRERPRRRDGPEHAARLNGTTKGERRREPGGYDSSSTLMSSELETTSFFDSDEDDSTSRF SSSTEQSSASRL
Dishevelled |
![]() |
---|
PFAM accession number: | PF02377 |
---|---|
Interpro abstract (IPR003351): | This domain is specific to the signalling protein dishevelled. Dishevelled (Dsh/Dvl) is a highly conserved protein family that plays an important role in mediating Wnt signaling. Wnt signal transduction pathways control a variety of developmental and homeostatic events. Dishevelled is involved in both the canonical and non-canonical (B-catenin-independent) pathways [ (PUBMED:20006983) ]. This domain is found adjacent to the PDZ domain ( IPR001478 ), often in conjunction with DEP ( IPR000591 ) and DIX ( IPR001158 ). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dishevelled