The domain within your query sequence starts at position 128 and ends at position 185; the E-value for the Dmrt1 domain shown below is 1.2e-16.
ELGISHPIPLPSAAELLVKRENNASNPCLMAENSSSAQPPPASTPTPAASDEDLREPP
Dmrt1 |
---|
PFAM accession number: | PF12374 |
---|---|
Interpro abstract (IPR022114): | This family is found in eukaryotes, and is typically between 61 and 73 amino acids in length. They are suggested to be transcription factor proteins. In Xenopus laevis, doublesex- and mab-3-related transcription factor 1a (dmrt1-a) is a transcription factor that plays a key role in male sex determination and differentiation by controlling testis development and germ cell proliferation. It acts both as a transcription repressor and activator [ (PUBMED:17118014) (PUBMED:20573695) ]. However, the other family member in Xenopus laevis, doublesex- and mab-3-related transcription factor DM-W (dm-w), is a transcription factor that plays a key role in female sex determination and primary ovary development. It acts as a sex-determining protein by antagonizing the transcriptional activity of male-determination protein dmrt1-a, acting as a dominant-negative type protein [ (PUBMED:18268317) (PUBMED:20573695) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dmrt1