The domain within your query sequence starts at position 68 and ends at position 284; the E-value for the Dna2 domain shown below is 4.7e-75.
HVTASQDREHEVLCILRNGWSSVPVEPGDIVHLEGDCTSEPWIIDDDFGYFILYPDMMIS GTSVASSIRCLRRAVLSETFRGSDPATRQMLIGTILHEVFQKAISESFAPERLQELALQT LREVRHLKEMYRLNLSQDEILCEVEEYLPSFSKWAEDFMRKGPSSEFPQMQLSLPSDGSN RSSPCNIEVVKSLDIEESIWSPRFGLKGKIDVTVGVK
Dna2 |
---|
PFAM accession number: | PF08696 |
---|---|
Interpro abstract (IPR014808): | Dna2 is a DNA replication factor with single-stranded DNA-dependent ATPase, ATP-dependent nuclease, (5'-flap endonuclease) and helicase activities. It is required for Okazaki fragment processing and is involved in DNA repair pathways [ (PUBMED:10880469) (PUBMED:22570407) ]. The helicase activity is weak and its function remains unclear [ (PUBMED:10636853) (PUBMED:16595799) (PUBMED:16595800) (PUBMED:20019387) ]. This entry represents N-terminal domain of the DNA replication factor Dna2. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dna2