SMART: Pfam domain Dpy19

The domain within your query sequence starts at position 59 and ends at position 714; the E-value for the Dpy19 domain shown below is 3e-213.

VISGMMHVFYLSAYHERKFWFSNRQELEREITFQGDSAIYYSYYKDMLKAPSFERGVYEL
THNNKTISLKTINAMQQMSLYPELIASVLYQATGSNEVIEPVYFYIGIVFGLQGMYVTAL
FVTSWLMSGTWLAGMLTVAWFLINRVDTTRIEYSIPLRENWALPYFACQVAALTGYLKRN
LNTYAERFCYLLLSTSTYTFMMVWEYSHYVLFLQAVSLLLLDIFSVEQSDKVYEVYKVYI
FSLFLGYLLQFENPALLVSPLLSLVGAFMLVKCLQLNGKKGTFVAKVIKVFEFYLLCTLP
VTLNLIVKMFVPHKENEHVLKFLEVKFGLNMTKNFTLNWLLCQESLQAPSQDFFFRLTQS
SLLPFYVLVLIICLLSMTQVFFRRMSGKSKKETVTLEDGRIGERPEIIYHVIHTLLLGSL
AMLMEGLKFIWTPYVCMLAAFGVCSPELWMTLLKWLRLRTVHPMLLALILSMAVPTIIGL
SLWKEFFPRLITELTELQEFYDPDTVELMTWIKRQAPVAAVFAGSPQLMGVIKLCTGWTV
TSLPLYSDDDLLQRNENIYQIYSKRSAEDIYKILTSYKANYLIVEDAICNELGTTRGCRV
KDLLDIANGHVVFEEGDKLTYSKYGRFCHEVKINYSPYVNYFTRVYWNRSYFVYKV

Dpy19

PFAM accession number:	PF10034
Interpro abstract (IPR018732):	This entry represents the Dpy-19 protein from Caenorhabditis elegans and its homologues in other Metazoa, including mammals. In C. elegans, Dpy-19 is required to orient neuroblasts QL and QR correctly on the anterior/posterior (A/P) axis. These neuroblasts are born in the same A/P position, but polarise and migrate left/right asymmetrically, where QL migrates toward the posterior and QR migrates toward the anterior. After their migrations, QL (but not QR) switches on the Hox gene mab-5. Dpy-19 is required along with Unc-40 to express Mab-5 correctly in the Q cell descendants [ (PUBMED:11023868) ]. A mammalian dpy-19 homologue was found to be expressed in GABAergic neurons [ (PUBMED:15944814) ]. The mammalian homologue of Mab-5 is the Gsh2 homeobox transcription factor, which plays a crucial role in the development of GABAergic neurons. Dpy-19 has been shown recently to be a C-mannosyltransferase that mediates C-mannosylation of tryptophan residues [ (PUBMED:23562325) ].
GO component:	integral component of membrane (GO:0016021)

PFAM accession number:

PF10034

Interpro abstract (IPR018732):

This entry represents the Dpy-19 protein from Caenorhabditis elegans and its homologues in other Metazoa, including mammals. In C. elegans, Dpy-19 is required to orient neuroblasts QL and QR correctly on the anterior/posterior (A/P) axis. These neuroblasts are born in the same A/P position, but polarise and migrate left/right asymmetrically, where QL migrates toward the posterior and QR migrates toward the anterior. After their migrations, QL (but not QR) switches on the Hox gene mab-5. Dpy-19 is required along with Unc-40 to express Mab-5 correctly in the Q cell descendants [ (PUBMED:11023868) ].

A mammalian dpy-19 homologue was found to be expressed in GABAergic neurons [ (PUBMED:15944814) ]. The mammalian homologue of Mab-5 is the Gsh2 homeobox transcription factor, which plays a crucial role in the development of GABAergic neurons.

Dpy-19 has been shown recently to be a C-mannosyltransferase that mediates C-mannosylation of tryptophan residues [ (PUBMED:23562325) ].

GO component:

integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dpy19