The domain within your query sequence starts at position 37 and ends at position 343; the E-value for the Draxin domain shown below is 3.1e-138.

LPETHSHLPSSALWVSQASHHGRRGLGKKDRGPGRPSRAQEGAVVTATKQASQMTLGQPP
AGLLQNKELLLGLTLPYPEKEARSPAWERVKKRGREHKRRRDRLRLHRGRAAIRGPSSLM
KKVEPSEDRMLEGTMEESSTSLAPTMFFLTMTDGATPTTEESRILPVTSLRPQTQPRSDG
EVMPTLDMALFDWTDYEDLKPEVWPSAKKKEKHWSHFTSDGNETSPAEGDPCDHHQDCLP
GTCCDLREHLCTPHNRGLNNKCFDDCMCMEGLRCYAKFHRNRRVTRRKGRCVEPETANGD
QGSFINI

Draxin

Draxin
PFAM accession number:PF15550
Interpro abstract (IPR029094):

Draxin is a chemorepulsive axon guidance protein required for the neural development [ (PUBMED:19857465) ]. It acts as a Wnt antagonist that is predominantly expressed in developing neural tissues [ (PUBMED:22265871) ].

GO process:axon guidance (GO:0007411), Wnt signaling pathway (GO:0016055)
GO component:extracellular region (GO:0005576)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Draxin