SMART: Pfam domain Dynactin

The domain within your query sequence starts at position 526 and ends at position 805; the E-value for the Dynactin domain shown below is 3.3e-90.

HLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHM
SLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFDLSENCSERPGLRGA
AGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIEL
LHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQSALDCMGVEVG
RLRAFLQGGQEATDIALLLRDLETSCSDTRQFCKKIRRRM

Dynactin

PFAM accession number:	PF12455
Interpro abstract (IPR022157):	This domain is found in eukaryotes, and is approximately 280 amino acids in length. The family is found in association with . There is a single completely conserved residue E that may be functionally important. Dynactin has been associated with Dynein, a kinesin protein which is involved in organelle transport, mitotic spindle assembly and chromosome segregation. Dynactin anchors Dynein to specific subcellular structures [ (PUBMED:9235942) ].

PFAM accession number:

PF12455

Interpro abstract (IPR022157):

This domain is found in eukaryotes, and is approximately 280 amino acids in length. The family is found in association with . There is a single completely conserved residue E that may be functionally important. Dynactin has been associated with Dynein, a kinesin protein which is involved in organelle transport, mitotic spindle assembly and chromosome segregation. Dynactin anchors Dynein to specific subcellular structures [ (PUBMED:9235942) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dynactin