The domain within your query sequence starts at position 1 and ends at position 149; the E-value for the Dynactin_p22 domain shown below is 1.4e-63.
MAALTDVQRLQSRVEELERWVYGPGGTRGSRKVADGLVKVQVALGNIASKRERVKILYKK IEDLIKYLDPEYIDRIAIPEASKLQFILAEEQFILSQVALLEQVNALVPVLDSASIKAVP EHAARLQRLAQIHIQQQFVQWDELLCQLE
Dynactin_p22 |
---|
PFAM accession number: | PF07426 |
---|---|
Interpro abstract (IPR009991): | DCTN3 is the smallest subunit of dynactin, a complex that binds to cytoplasmic dynein and is a required activator for cytoplasmic dynein-mediated vesicular transport. Dynactin localises to the cleavage furrow and to the midbodies of dividing cells, suggesting that it may function in cytokinesis [ (PUBMED:9722614) ]. |
GO process: | cytoskeleton-dependent cytokinesis (GO:0061640) |
GO component: | dynactin complex (GO:0005869) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dynactin_p22