The domain within your query sequence starts at position 1 and ends at position 149; the E-value for the Dynactin_p22 domain shown below is 1.4e-63.

MAALTDVQRLQSRVEELERWVYGPGGTRGSRKVADGLVKVQVALGNIASKRERVKILYKK
IEDLIKYLDPEYIDRIAIPEASKLQFILAEEQFILSQVALLEQVNALVPVLDSASIKAVP
EHAARLQRLAQIHIQQQFVQWDELLCQLE

Dynactin_p22

• PFAM accession number: PF07426
• Interpro abstract (IPR009991):

  DCTN3 is the smallest subunit of dynactin, a complex that binds to cytoplasmic dynein and is a required activator for cytoplasmic dynein-mediated vesicular transport. Dynactin localises to the cleavage furrow and to the midbodies of dividing cells, suggesting that it may function in cytokinesis [ (PUBMED:9722614) ].

• GO process: cytoskeleton-dependent cytokinesis (GO:0061640)
• GO component: dynactin complex (GO:0005869)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dynactin_p22