The domain within your query sequence starts at position 1 and ends at position 163; the E-value for the Dynamin_M domain shown below is 2.4e-55.
XDFEKRIEGSGDQVDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHG VRTGLFTPDMAFEAIVKKQLVKLKEPSLKCVDLVVSELATVIKKCAEKLSSYPRLREETE RIVTTYIREREGRTKDQILLLIDIEQSYINTNHEDFIGFANCF
Dynamin_M |
![]() |
---|
PFAM accession number: | PF01031 |
---|---|
Interpro abstract (IPR000375): | Dynamin is a microtubule-associated force-producing protein of 100 Kd which is involved in the production of microtubule bundles. At the N terminus of dynamin is a GTPase domain (see IPR001401 ), and at the C terminus is a PH domain (see IPR001849 ). Between these two domains lies a central region of unknown function, which this entry represents. |
GO function: | GTP binding (GO:0005525) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dynamin_M