The domain within your query sequence starts at position 297 and ends at position 365; the E-value for the E1_4HB domain shown below is 3.5e-29.
PRKINFKPLLASLAEPEFVVTDFAKCCHPAQLHIGFQALHQFCTQHSRPPRPHNEEDAEE LVTLAQSVN
E1_4HB |
 |
|---|
| PFAM accession number: | PF16191 |
|---|---|
| Interpro abstract (IPR032420): | This domain is found in the ubiquitin-activating E1 family enzymes and is C-terminal to the FCCH domain [ (PUBMED:18662542) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry E1_4HB