The domain within your query sequence starts at position 178 and ends at position 249; the E-value for the E1_FCCH domain shown below is 1.1e-26.
GFPGIVTLRGDTKRHSFHDGDLVIFSDIEGMVELNSCSPQSVRVQKDGSLEIGDTTTFSR YLRGGVVTEVKR
E1_FCCH |
 |
|---|
| PFAM accession number: | PF16190 |
|---|---|
| Interpro abstract (IPR032418): | This domain is found in the ubiquitin-activating E1 (Ub-E1) family enzymes. It is one of the catalytic cysteine half-domains of Ub-E1. The catalytic cysteine half-domains contain the E1 active site cysteine, and are known as FCCH and SCCH, for 'first' and 'second' catalytic cysteine half-domain, respectively [ (PUBMED:18662542) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry E1_FCCH