The domain within your query sequence starts at position 123 and ends at position 221; the E-value for the E2F_CC-MB domain shown below is 6.9e-35.
LKAEIEDLELKERELDQQKLWLQQSIKNVMEDSINNSTFSYVTHEDICNCFHGDTLLAIQ APSGTQLEVPIPEMGQNGQKKYQINLKSHSGPIHVLLIN
E2F_CC-MB |
 |
|---|
| PFAM accession number: | PF16421 |
|---|---|
| Interpro abstract (IPR032198): | This is the coiled coil (CC) - marked box (MB) domain of E2F transcription factors. This domain forms a heterodimer with the corresponding domain of the DP transcription factor, the heterodimer binds the C terminus of retinoblastoma protein [ (PUBMED:16360038) ]. |
| GO function: | protein dimerization activity (GO:0046983) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry E2F_CC-MB