The domain within your query sequence starts at position 50 and ends at position 132; the E-value for the E2F_TDP domain shown below is 1e-26.

KNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSEFTNSNNHLAADSQAYDQKNIRRRVY
DALNVLMAMNIISKEKKEIKWIG

E2F_TDP

E2F_TDP
PFAM accession number:PF02319
Interpro abstract (IPR003316):

This entry represents the DNA-binding domain of the E2F and DP proteins, which have a fold related to the winged-helix DNA-binding motif [ (PUBMED:10090723) ]. The mammalian transcription factor E2F plays an important role in regulating the expression of genes that are required for passage through the cell cycle. Multiple E2F family members have been identified that bind to DNA as heterodimers, interacting with proteins known as DP - the dimerisation partners [ (PUBMED:7739537) ].

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO component:transcription regulator complex (GO:0005667)
GO function:DNA-binding transcription factor activity (GO:0003700)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry E2F_TDP