The domain within your query sequence starts at position 6 and ends at position 225; the E-value for the EAP30 domain shown below is 7.6e-66.
VGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFR VQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELH QQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQ LAEKNGYVTVSEIKTSLKWETERARQVLEHLLKEGLAWLD
EAP30 |
---|
PFAM accession number: | PF04157 |
---|---|
Interpro abstract (IPR040608): | This family includes Snf8 and Vps36. Vps36 is involved in Golgi to endosome trafficking. Snf8 is a component of the endosomal sorting complex required for transport II (ESCRT-II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs [ (PUBMED:12194858) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EAP30