The domain within your query sequence starts at position 230 and ends at position 355; the E-value for the EBP50_C domain shown below is 1.4e-47.
TDEFFKKCKVIPSQEHLDGPLPEPFSNGEIQKESSREALVEPASESPRPALARSASSDTS EELNSQDSPKRQVSTEPSSTSSSSSDPILDLNISLAVAKERAHQKRSSKRAPQMDWSKKN ELFSNL
EBP50_C |
---|
PFAM accession number: | PF09007 |
---|---|
Interpro abstract (IPR015098): | This C-terminal domain allows interaction of EBP50 with FERM (four-point one ERM) domains, resulting in the activation of Ezrin-radixin-moesin (ERM), with subsequent cytoskeletal modulation and cellular growth control [ (PUBMED:15020681) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EBP50_C